NXT1 polyclonal antibody (A01)
  • NXT1 polyclonal antibody (A01)

NXT1 polyclonal antibody (A01)

Ref: AB-H00029107-A01
NXT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NXT1.
Información adicional
Size 50 uL
Gene Name NXT1
Gene Alias MTR2|P15
Gene Description NTF2-like export factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29107

Enviar un mensaje


NXT1 polyclonal antibody (A01)

NXT1 polyclonal antibody (A01)