Ver mas grande
N6AMT1 MaxPab rabbit polyclonal antibody (D01)
AB-H00029104-D01
Producto nuevo
N6AMT1 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | N6AMT1 |
| Gene Alias | C21orf127|HEMK2|MGC19995|MTQ2|N6AMT|PRED28 |
| Gene Description | N-6 adenine-specific DNA methyltransferase 1 (putative) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | N6AMT1 (AAH11554.1, 1 a.a. ~ 186 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 29104 |
Más información
Rabbit polyclonal antibody raised against a full-length human N6AMT1 protein.