UBE2T monoclonal antibody (M03), clone 2A12-4F11
  • UBE2T monoclonal antibody (M03), clone 2A12-4F11

UBE2T monoclonal antibody (M03), clone 2A12-4F11

Ref: AB-H00029089-M03
UBE2T monoclonal antibody (M03), clone 2A12-4F11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBE2T.
Información adicional
Size 100 ug
Gene Name UBE2T
Gene Alias HSPC150|PIG50
Gene Description ubiquitin-conjugating enzyme E2T (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29089
Clone Number 2A12-4F11
Iso type IgG1 Kappa

Enviar un mensaje


UBE2T monoclonal antibody (M03), clone 2A12-4F11

UBE2T monoclonal antibody (M03), clone 2A12-4F11