UBE2T monoclonal antibody (M01), clone 1E12-4A3
  • UBE2T monoclonal antibody (M01), clone 1E12-4A3

UBE2T monoclonal antibody (M01), clone 1E12-4A3

Ref: AB-H00029089-M01
UBE2T monoclonal antibody (M01), clone 1E12-4A3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant UBE2T.
Información adicional
Size 100 ug
Gene Name UBE2T
Gene Alias HSPC150|PIG50
Gene Description ubiquitin-conjugating enzyme E2T (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IP,ELISA
Immunogen Prot. Seq MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29089
Clone Number 1E12-4A3
Iso type IgG2b kappa

Enviar un mensaje


UBE2T monoclonal antibody (M01), clone 1E12-4A3

UBE2T monoclonal antibody (M01), clone 1E12-4A3