ZC3H7A MaxPab mouse polyclonal antibody (B01P)
  • ZC3H7A MaxPab mouse polyclonal antibody (B01P)

ZC3H7A MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029066-B01P
ZC3H7A MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZC3H7A protein.
Información adicional
Size 50 ug
Gene Name ZC3H7A
Gene Alias FLJ10027|FLJ20318|HSPC055|ZC3H7|ZC3HDC7
Gene Description zinc finger CCCH-type containing 7A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFGKYSFLFKDLN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZC3H7A (AAH12575, 1 a.a. ~ 167 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29066

Enviar un mensaje


ZC3H7A MaxPab mouse polyclonal antibody (B01P)

ZC3H7A MaxPab mouse polyclonal antibody (B01P)