C20orf30 polyclonal antibody (A01)
  • C20orf30 polyclonal antibody (A01)

C20orf30 polyclonal antibody (A01)

Ref: AB-H00029058-A01
C20orf30 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant C20orf30.
Información adicional
Size 50 uL
Gene Name C20orf30
Gene Alias HSPC274|dJ1116H23.2.1
Gene Description chromosome 20 open reading frame 30
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C20orf30 (AAH09768, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29058

Enviar un mensaje


C20orf30 polyclonal antibody (A01)

C20orf30 polyclonal antibody (A01)