KLF15 monoclonal antibody (M02), clone 1F3
  • KLF15 monoclonal antibody (M02), clone 1F3

KLF15 monoclonal antibody (M02), clone 1F3

Ref: AB-H00028999-M02
KLF15 monoclonal antibody (M02), clone 1F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF15.
Información adicional
Size 100 ug
Gene Name KLF15
Gene Alias DKFZp779M1320|KKLF
Gene Description Kruppel-like factor 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF15 (NP_054798.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28999
Clone Number 1F3
Iso type IgG2b Kappa

Enviar un mensaje


KLF15 monoclonal antibody (M02), clone 1F3

KLF15 monoclonal antibody (M02), clone 1F3