MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)
  • MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)

MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00028998-D01P
MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MRPL13 protein.
Información adicional
Size 100 ug
Gene Name MRPL13
Gene Alias L13|L13A|L13mt|RPL13|RPML13
Gene Description mitochondrial ribosomal protein L13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti
Immunogen Prot. Seq MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPL13 (NP_054797.2, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28998

Enviar un mensaje


MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)

MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)