SNX24 monoclonal antibody (M01), clone 2A11
  • SNX24 monoclonal antibody (M01), clone 2A11

SNX24 monoclonal antibody (M01), clone 2A11

Ref: AB-H00028966-M01
SNX24 monoclonal antibody (M01), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SNX24.
Información adicional
Size 100 ug
Gene Name SNX24
Gene Alias PRO1284|SBBI31
Gene Description sorting nexin 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX24 (AAH10886, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28966
Clone Number 2A11
Iso type IgG2a Kappa

Enviar un mensaje


SNX24 monoclonal antibody (M01), clone 2A11

SNX24 monoclonal antibody (M01), clone 2A11