REM1 monoclonal antibody (M02), clone 3A9
  • REM1 monoclonal antibody (M02), clone 3A9

REM1 monoclonal antibody (M02), clone 3A9

Ref: AB-H00028954-M02
REM1 monoclonal antibody (M02), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant REM1.
Información adicional
Size 100 ug
Gene Name REM1
Gene Alias GD:REM|GES|MGC48669|REM
Gene Description RAS (RAD and GEM)-like GTP-binding 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen REM1 (NP_054731, 162 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28954
Clone Number 3A9
Iso type IgG2a Kappa

Enviar un mensaje


REM1 monoclonal antibody (M02), clone 3A9

REM1 monoclonal antibody (M02), clone 3A9