IGLV4-3 MaxPab mouse polyclonal antibody (B01P)
  • IGLV4-3 MaxPab mouse polyclonal antibody (B01P)

IGLV4-3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00028786-B01P
IGLV4-3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IGLV4-3 protein.
Información adicional
Size 50 ug
Gene Name IGLV4-3
Gene Alias IGLV43|V5-1
Gene Description immunoglobulin lambda variable 4-3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAWVSFYLLPFIFSTGLCALPVLTQPPSASAFLGASIKLTCTLSREHSSYTIEWYQQRPGRSPQYIMKVKSDGSHNKGDGIPDRFMGSSSGADRYLTLSNLQSDDEAEYHCGESHTIDGQVGWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGLV4-3 (AAH20236.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28786

Enviar un mensaje


IGLV4-3 MaxPab mouse polyclonal antibody (B01P)

IGLV4-3 MaxPab mouse polyclonal antibody (B01P)