TRDD3 purified MaxPab mouse polyclonal antibody (B01P)
  • TRDD3 purified MaxPab mouse polyclonal antibody (B01P)

TRDD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00028523-B01P
TRDD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRDD3 protein.
Información adicional
Size 50 ug
Gene Name TRDD3
Gene Alias TCRD
Gene Description T cell receptor delta diversity 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MLFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKEVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESFLPFRGNFHYTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTRSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRDD3 (AAH22317, 1 a.a. ~ 296 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28523

Enviar un mensaje


TRDD3 purified MaxPab mouse polyclonal antibody (B01P)

TRDD3 purified MaxPab mouse polyclonal antibody (B01P)