NKIRAS1 monoclonal antibody (M01), clone 2A7
  • NKIRAS1 monoclonal antibody (M01), clone 2A7

NKIRAS1 monoclonal antibody (M01), clone 2A7

Ref: AB-H00028512-M01
NKIRAS1 monoclonal antibody (M01), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NKIRAS1.
Información adicional
Size 100 ug
Gene Name NKIRAS1
Gene Alias KBRAS1|kappaB-Ras1
Gene Description NFKB inhibitor interacting Ras-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NKIRAS1 (AAH12145, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28512
Clone Number 2A7
Iso type IgG2a Kappa

Enviar un mensaje


NKIRAS1 monoclonal antibody (M01), clone 2A7

NKIRAS1 monoclonal antibody (M01), clone 2A7