PCLO purified MaxPab mouse polyclonal antibody (B01P)
  • PCLO purified MaxPab mouse polyclonal antibody (B01P)

PCLO purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027445-B01P
PCLO purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCLO protein.
Información adicional
Size 50 ug
Gene Name PCLO
Gene Alias ACZ|DKFZp779G1236
Gene Description piccolo (presynaptic cytomatrix protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKKFRVSLVSKVGKQKYVDLNMLSDSENSQHLELHEPPKAVDKAKSPGVDPKQLAAELQKVSLQQSPLVLSSVVEKGSHVHSGPTSAGSSSVPSPGQPGSPSVSKKKHGSSKPTDGTKVVSHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTAHLDNTPRWYPLKEQTESIDH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCLO (AAH01304.2, 1 a.a. ~ 356 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27445

Enviar un mensaje


PCLO purified MaxPab mouse polyclonal antibody (B01P)

PCLO purified MaxPab mouse polyclonal antibody (B01P)