EML4 monoclonal antibody (M01), clone 3C10
  • EML4 monoclonal antibody (M01), clone 3C10

EML4 monoclonal antibody (M01), clone 3C10

Ref: AB-H00027436-M01
EML4 monoclonal antibody (M01), clone 3C10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant EML4.
Información adicional
Size 100 ug
Gene Name EML4
Gene Alias C2orf2|DKFZp686P18118|ELP120|FLJ10942|FLJ32318|ROPP120
Gene Description echinoderm microtubule associated protein like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EML4 (AAH08685, 1 a.a. ~ 62 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27436
Clone Number 3C10
Iso type IgG1 Kappa

Enviar un mensaje


EML4 monoclonal antibody (M01), clone 3C10

EML4 monoclonal antibody (M01), clone 3C10