TOR2A polyclonal antibody (A01)
  • TOR2A polyclonal antibody (A01)

TOR2A polyclonal antibody (A01)

Ref: AB-H00027433-A01
TOR2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOR2A.
Información adicional
Size 50 uL
Gene Name TOR2A
Gene Alias FLJ14771|MGC99558|TORP1
Gene Description torsin family 2, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOR2A (NP_569726, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27433

Enviar un mensaje


TOR2A polyclonal antibody (A01)

TOR2A polyclonal antibody (A01)