HTRA2 monoclonal antibody (M03), clone 3G5
  • HTRA2 monoclonal antibody (M03), clone 3G5

HTRA2 monoclonal antibody (M03), clone 3G5

Ref: AB-H00027429-M03
HTRA2 monoclonal antibody (M03), clone 3G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTRA2.
Información adicional
Size 100 ug
Gene Name HTRA2
Gene Alias OMI|PARK13|PRSS25
Gene Description HtrA serine peptidase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTRA2 (AAH00096, 359 a.a. ~ 458 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27429
Clone Number 3G5
Iso type IgG1 Kappa

Enviar un mensaje


HTRA2 monoclonal antibody (M03), clone 3G5

HTRA2 monoclonal antibody (M03), clone 3G5