UBE2S monoclonal antibody (M01), clone 3D5
  • UBE2S monoclonal antibody (M01), clone 3D5

UBE2S monoclonal antibody (M01), clone 3D5

Ref: AB-H00027338-M01
UBE2S monoclonal antibody (M01), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant UBE2S.
Información adicional
Size 100 ug
Gene Name UBE2S
Gene Alias E2-EPF|E2EPF|EPF5
Gene Description ubiquitin-conjugating enzyme E2S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2S (AAH04236, 1 a.a. ~ 222 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27338
Clone Number 3D5
Iso type IgG1 Kappa

Enviar un mensaje


UBE2S monoclonal antibody (M01), clone 3D5

UBE2S monoclonal antibody (M01), clone 3D5