UBE2S purified MaxPab mouse polyclonal antibody (B01P)
  • UBE2S purified MaxPab mouse polyclonal antibody (B01P)

UBE2S purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027338-B01P
UBE2S purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBE2S protein.
Información adicional
Size 50 ug
Gene Name UBE2S
Gene Alias E2-EPF|E2EPF|EPF5
Gene Description ubiquitin-conjugating enzyme E2S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2S (NP_055316.2, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27338

Enviar un mensaje


UBE2S purified MaxPab mouse polyclonal antibody (B01P)

UBE2S purified MaxPab mouse polyclonal antibody (B01P)