PGDS purified MaxPab rabbit polyclonal antibody (D01P)
  • PGDS purified MaxPab rabbit polyclonal antibody (D01P)

PGDS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027306-D01P
PGDS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PGDS protein.
Información adicional
Size 100 ug
Gene Name PGDS
Gene Alias -
Gene Description prostaglandin D2 synthase, hematopoietic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGDS (NP_055300.1, 1 a.a. ~ 199 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27306

Enviar un mensaje


PGDS purified MaxPab rabbit polyclonal antibody (D01P)

PGDS purified MaxPab rabbit polyclonal antibody (D01P)