RCP9 polyclonal antibody (A01)
  • RCP9 polyclonal antibody (A01)

RCP9 polyclonal antibody (A01)

Ref: AB-H00027297-A01
RCP9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RCP9.
Información adicional
Size 50 uL
Gene Name CRCP
Gene Alias CGRP-RCP|MGC111194|RCP|RCP9
Gene Description CGRP receptor component
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RCP9 (NP_055293, 39 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27297

Enviar un mensaje


RCP9 polyclonal antibody (A01)

RCP9 polyclonal antibody (A01)