DHDH monoclonal antibody (M03), clone 3A11
  • DHDH monoclonal antibody (M03), clone 3A11

DHDH monoclonal antibody (M03), clone 3A11

Ref: AB-H00027294-M03
DHDH monoclonal antibody (M03), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DHDH.
Información adicional
Size 100 ug
Gene Name DHDH
Gene Alias HUM2DD
Gene Description dihydrodiol dehydrogenase (dimeric)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHDH (NP_055290, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27294
Clone Number 3A11
Iso type IgG2a Kappa

Enviar un mensaje


DHDH monoclonal antibody (M03), clone 3A11

DHDH monoclonal antibody (M03), clone 3A11