DHDH purified MaxPab rabbit polyclonal antibody (D01P)
  • DHDH purified MaxPab rabbit polyclonal antibody (D01P)

DHDH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027294-D01P
DHDH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DHDH protein.
Información adicional
Size 100 ug
Gene Name DHDH
Gene Alias HUM2DD
Gene Description dihydrodiol dehydrogenase (dimeric)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DHDH (NP_055290.1, 1 a.a. ~ 334 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27294

Enviar un mensaje


DHDH purified MaxPab rabbit polyclonal antibody (D01P)

DHDH purified MaxPab rabbit polyclonal antibody (D01P)