RND1 purified MaxPab mouse polyclonal antibody (B01P)
  • RND1 purified MaxPab mouse polyclonal antibody (B01P)

RND1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027289-B01P
RND1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RND1 protein.
Información adicional
Size 50 ug
Gene Name RND1
Gene Alias ARHS|FLJ42294|RHO6|RHOS
Gene Description Rho family GTPase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RND1 (NP_055285, 1 a.a. ~ 232 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27289

Enviar un mensaje


RND1 purified MaxPab mouse polyclonal antibody (B01P)

RND1 purified MaxPab mouse polyclonal antibody (B01P)