SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)

SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027284-D01P
SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SULT1B1 protein.
Información adicional
Size 100 ug
Gene Name SULT1B1
Gene Alias MGC13356|ST1B2|SULT1B2
Gene Description sulfotransferase family, cytosolic, 1B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SULT1B1 (NP_055280.2, 1 a.a. ~ 296 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27284

Enviar un mensaje


SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)

SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)