PIPPIN monoclonal antibody (M01), clone 2H8
  • PIPPIN monoclonal antibody (M01), clone 2H8

PIPPIN monoclonal antibody (M01), clone 2H8

Ref: AB-H00027254-M01
PIPPIN monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PIPPIN.
Información adicional
Size 100 ug
Gene Name CSDC2
Gene Alias PIPPIN|dJ347H13.2
Gene Description cold shock domain containing C2, RNA binding
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIPPIN (AAH67113, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27254
Clone Number 2H8
Iso type IgG1 Kappa

Enviar un mensaje


PIPPIN monoclonal antibody (M01), clone 2H8

PIPPIN monoclonal antibody (M01), clone 2H8