SESN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SESN1 purified MaxPab rabbit polyclonal antibody (D01P)

SESN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027244-D01P
SESN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SESN1 protein.
Información adicional
Size 100 ug
Gene Name SESN1
Gene Alias MGC138241|MGC142129|PA26|RP11-787I22.1|SEST1
Gene Description sestrin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSDGLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SESN1 (NP_055269.1, 1 a.a. ~ 551 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27244

Enviar un mensaje


SESN1 purified MaxPab rabbit polyclonal antibody (D01P)

SESN1 purified MaxPab rabbit polyclonal antibody (D01P)