SESN1 polyclonal antibody (A01)
  • SESN1 polyclonal antibody (A01)

SESN1 polyclonal antibody (A01)

Ref: AB-H00027244-A01
SESN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SESN1.
Información adicional
Size 50 uL
Gene Name SESN1
Gene Alias MGC138241|MGC142129|PA26|RP11-787I22.1|SEST1
Gene Description sestrin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRESMFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SESN1 (NM_014454, 271 a.a. ~ 370 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27244

Enviar un mensaje


SESN1 polyclonal antibody (A01)

SESN1 polyclonal antibody (A01)