TUBGCP4 purified MaxPab rabbit polyclonal antibody (D01P)
  • TUBGCP4 purified MaxPab rabbit polyclonal antibody (D01P)

TUBGCP4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027229-D01P
TUBGCP4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBGCP4 protein.
Información adicional
Size 100 ug
Gene Name TUBGCP4
Gene Alias 76P|FLJ14797|GCP4
Gene Description tubulin, gamma complex associated protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIEQYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSISHVNYFLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCHGVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQDLRLIEEENMLAPSLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBGCP4 (NP_055259.2, 1 a.a. ~ 666 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27229

Enviar un mensaje


TUBGCP4 purified MaxPab rabbit polyclonal antibody (D01P)

TUBGCP4 purified MaxPab rabbit polyclonal antibody (D01P)