IL17B monoclonal antibody (M01), clone 6G5
  • IL17B monoclonal antibody (M01), clone 6G5

IL17B monoclonal antibody (M01), clone 6G5

Ref: AB-H00027190-M01
IL17B monoclonal antibody (M01), clone 6G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL17B.
Información adicional
Size 100 ug
Gene Name IL17B
Gene Alias IL-17B|IL-20|MGC138900|MGC138901|ZCYTO7
Gene Description interleukin 17B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL17B (NP_055258, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27190
Clone Number 6G5
Iso type IgG2a Kappa

Enviar un mensaje


IL17B monoclonal antibody (M01), clone 6G5

IL17B monoclonal antibody (M01), clone 6G5