SIGLEC8 polyclonal antibody (A01)
  • SIGLEC8 polyclonal antibody (A01)

SIGLEC8 polyclonal antibody (A01)

Ref: AB-H00027181-A01
SIGLEC8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SIGLEC8.
Información adicional
Size 50 uL
Gene Name SIGLEC8
Gene Alias MGC59785|SAF2|SIGLEC-8|SIGLEC8L
Gene Description sialic acid binding Ig-like lectin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIGLEC8 (NP_055257, 18 a.a. ~ 121 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27181

Enviar un mensaje


SIGLEC8 polyclonal antibody (A01)

SIGLEC8 polyclonal antibody (A01)