IL1F6 purified MaxPab mouse polyclonal antibody (B01P)
  • IL1F6 purified MaxPab mouse polyclonal antibody (B01P)

IL1F6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027179-B01P
IL1F6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL1F6 protein.
Información adicional
Size 50 ug
Gene Name IL1F6
Gene Alias FIL1|FIL1(EPSILON)|FIL1E|IL-1F6|IL1(EPSILON)|MGC129552|MGC129553
Gene Description interleukin 1 family, member 6 (epsilon)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL1F6 (NP_055255.1, 1 a.a. ~ 158 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27179

Enviar un mensaje


IL1F6 purified MaxPab mouse polyclonal antibody (B01P)

IL1F6 purified MaxPab mouse polyclonal antibody (B01P)