IL1F8 monoclonal antibody (M01), clone 1E4
  • IL1F8 monoclonal antibody (M01), clone 1E4

IL1F8 monoclonal antibody (M01), clone 1E4

Ref: AB-H00027177-M01
IL1F8 monoclonal antibody (M01), clone 1E4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IL1F8.
Información adicional
Size 100 ug
Gene Name IL1F8
Gene Alias FIL1|FIL1-(ETA)|FIL1H|IL-1F8|IL-1H2|IL1-ETA|IL1H2|MGC126880|MGC126882
Gene Description interleukin 1 family, member 8 (eta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL1F8 (NP_775270.1, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27177
Clone Number 1E4
Iso type IgG2a Kappa

Enviar un mensaje


IL1F8 monoclonal antibody (M01), clone 1E4

IL1F8 monoclonal antibody (M01), clone 1E4