IL1F8 purified MaxPab mouse polyclonal antibody (B01P)
  • IL1F8 purified MaxPab mouse polyclonal antibody (B01P)

IL1F8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027177-B01P
IL1F8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL1F8 protein.
Información adicional
Size 50 ug
Gene Name IL1F8
Gene Alias FIL1|FIL1-(ETA)|FIL1H|IL-1F8|IL-1H2|IL1-ETA|IL1H2|MGC126880|MGC126882
Gene Description interleukin 1 family, member 8 (eta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL1F8 (NP_775270.1, 1 a.a. ~ 157 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27177

Enviar un mensaje


IL1F8 purified MaxPab mouse polyclonal antibody (B01P)

IL1F8 purified MaxPab mouse polyclonal antibody (B01P)