PRELID1 monoclonal antibody (M02), clone 6G1
  • PRELID1 monoclonal antibody (M02), clone 6G1

PRELID1 monoclonal antibody (M02), clone 6G1

Ref: AB-H00027166-M02
PRELID1 monoclonal antibody (M02), clone 6G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRELID1.
Información adicional
Size 100 ug
Gene Name PRELID1
Gene Alias CGI-106|MGC87972|PRELI|PX19
Gene Description PRELI domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRELID1 (NP_037369, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27166
Clone Number 6G1
Iso type IgG2a Kappa

Enviar un mensaje


PRELID1 monoclonal antibody (M02), clone 6G1

PRELID1 monoclonal antibody (M02), clone 6G1