CHIA purified MaxPab rabbit polyclonal antibody (D01P)
  • CHIA purified MaxPab rabbit polyclonal antibody (D01P)

CHIA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027159-D01P
CHIA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CHIA protein.
Información adicional
Size 100 ug
Gene Name CHIA
Gene Alias 2200003E03Rik|AMCase|CHIT2|DKFZp313J1722|RP5-1125M8.1|TSA1902
Gene Description chitinase, acidic
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAID
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CHIA (NP_068569.2, 1 a.a. ~ 368 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27159

Enviar un mensaje


CHIA purified MaxPab rabbit polyclonal antibody (D01P)

CHIA purified MaxPab rabbit polyclonal antibody (D01P)