NDOR1 monoclonal antibody (M02), clone 5A7
  • NDOR1 monoclonal antibody (M02), clone 5A7

NDOR1 monoclonal antibody (M02), clone 5A7

Ref: AB-H00027158-M02
NDOR1 monoclonal antibody (M02), clone 5A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDOR1.
Información adicional
Size 100 ug
Gene Name NDOR1
Gene Alias MGC138148|NR1|bA350O14.9
Gene Description NADPH dependent diflavin oxidoreductase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27158
Clone Number 5A7
Iso type IgG2a Kappa

Enviar un mensaje


NDOR1 monoclonal antibody (M02), clone 5A7

NDOR1 monoclonal antibody (M02), clone 5A7