RTDR1 monoclonal antibody (M02), clone 3B6
  • RTDR1 monoclonal antibody (M02), clone 3B6

RTDR1 monoclonal antibody (M02), clone 3B6

Ref: AB-H00027156-M02
RTDR1 monoclonal antibody (M02), clone 3B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RTDR1.
Información adicional
Size 100 ug
Gene Name RTDR1
Gene Alias MGC16968
Gene Description rhabdoid tumor deletion region gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq SNAAGALMFATVITEGKYAALEAQAIGLLLELLHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RTDR1 (NP_055248.1, 249 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27156
Clone Number 3B6
Iso type IgG2a Kappa

Enviar un mensaje


RTDR1 monoclonal antibody (M02), clone 3B6

RTDR1 monoclonal antibody (M02), clone 3B6