STK36 purified MaxPab rabbit polyclonal antibody (D01P)
  • STK36 purified MaxPab rabbit polyclonal antibody (D01P)

STK36 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027148-D01P
STK36 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STK36 protein.
Información adicional
Size 100 ug
Gene Name STK36
Gene Alias DKFZp434N0223|FU|KIAA1278
Gene Description serine/threonine kinase 36, fused homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRHPNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKDFLQGLLTKDPRQRLSWPDLLYHPFIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK36 (NP_056505.1, 1 a.a. ~ 1315 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27148

Enviar un mensaje


STK36 purified MaxPab rabbit polyclonal antibody (D01P)

STK36 purified MaxPab rabbit polyclonal antibody (D01P)