CIDEB monoclonal antibody (M12), clone 3H4
  • CIDEB monoclonal antibody (M12), clone 3H4

CIDEB monoclonal antibody (M12), clone 3H4

Ref: AB-H00027141-M12
CIDEB monoclonal antibody (M12), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CIDEB.
Información adicional
Size 100 ug
Gene Name CIDEB
Gene Alias -
Gene Description cell death-inducing DFFA-like effector b
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIDEB (AAH35970, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27141
Clone Number 3H4
Iso type IgG2b Kappa

Enviar un mensaje


CIDEB monoclonal antibody (M12), clone 3H4

CIDEB monoclonal antibody (M12), clone 3H4