MORC1 monoclonal antibody (M09), clone 3E8
  • MORC1 monoclonal antibody (M09), clone 3E8

MORC1 monoclonal antibody (M09), clone 3E8

Ref: AB-H00027136-M09
MORC1 monoclonal antibody (M09), clone 3E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MORC1.
Información adicional
Size 100 ug
Gene Name MORC1
Gene Alias MORC|ZCW6
Gene Description MORC family CW-type zinc finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MORC1 (NP_055244, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27136
Clone Number 3E8
Iso type IgG1 Kappa

Enviar un mensaje


MORC1 monoclonal antibody (M09), clone 3E8

MORC1 monoclonal antibody (M09), clone 3E8