CPNE7 polyclonal antibody (A01)
  • CPNE7 polyclonal antibody (A01)

CPNE7 polyclonal antibody (A01)

Ref: AB-H00027132-A01
CPNE7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CPNE7.
Información adicional
Size 50 uL
Gene Name CPNE7
Gene Alias MGC34192
Gene Description copine VII
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ASRLPMSIIIVGVGNADFTDMQVLDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPNE7 (NP_705900, 460 a.a. ~ 558 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27132

Enviar un mensaje


CPNE7 polyclonal antibody (A01)

CPNE7 polyclonal antibody (A01)