INVS polyclonal antibody (A01)
  • INVS polyclonal antibody (A01)

INVS polyclonal antibody (A01)

Ref: AB-H00027130-A01
INVS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant INVS.
Información adicional
Size 50 uL
Gene Name INVS
Gene Alias INV|KIAA0573|MGC133080|MGC133081|NPH2|NPHP2
Gene Description inversin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INVS (NP_055240, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27130

Enviar un mensaje


INVS polyclonal antibody (A01)

INVS polyclonal antibody (A01)