SMC1L2 monoclonal antibody (M01), clone 6A10
  • SMC1L2 monoclonal antibody (M01), clone 6A10

SMC1L2 monoclonal antibody (M01), clone 6A10

Ref: AB-H00027127-M01
SMC1L2 monoclonal antibody (M01), clone 6A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMC1L2.
Información adicional
Size 100 ug
Gene Name SMC1B
Gene Alias FLJ43748|SMC1BETA|SMC1L2|bK268H5|bK268H5.5
Gene Description structural maintenance of chromosomes 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq KVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMC1L2 (NP_683515, 551 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27127
Clone Number 6A10
Iso type IgG1 Kappa

Enviar un mensaje


SMC1L2 monoclonal antibody (M01), clone 6A10

SMC1L2 monoclonal antibody (M01), clone 6A10