AFF4 monoclonal antibody (M01), clone 2E12
  • AFF4 monoclonal antibody (M01), clone 2E12

AFF4 monoclonal antibody (M01), clone 2E12

Ref: AB-H00027125-M01
AFF4 monoclonal antibody (M01), clone 2E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AFF4.
Información adicional
Size 100 ug
Gene Name AFF4
Gene Alias AF5Q31|MCEF|MGC75036
Gene Description AF4/FMR2 family, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AFF4 (NP_055238, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27125
Clone Number 2E12
Iso type IgG1 Kappa

Enviar un mensaje


AFF4 monoclonal antibody (M01), clone 2E12

AFF4 monoclonal antibody (M01), clone 2E12