DKK4 purified MaxPab rabbit polyclonal antibody (D01P)
  • DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027121-D01P
DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DKK4 protein.
Información adicional
Size 100 ug
Gene Name DKK4
Gene Alias DKK-4|MGC129562|MGC129563
Gene Description dickkopf homolog 4 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DKK4 (NP_055235.1, 1 a.a. ~ 224 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27121

Enviar un mensaje


DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

DKK4 purified MaxPab rabbit polyclonal antibody (D01P)