PDE7B purified MaxPab rabbit polyclonal antibody (D01P)
  • PDE7B purified MaxPab rabbit polyclonal antibody (D01P)

PDE7B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027115-D01P
PDE7B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDE7B protein.
Información adicional
Size 100 ug
Gene Name PDE7B
Gene Alias MGC88256|bA472E5.1
Gene Description phosphodiesterase 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYSGEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDE7B (NP_061818.1, 1 a.a. ~ 450 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27115

Enviar un mensaje


PDE7B purified MaxPab rabbit polyclonal antibody (D01P)

PDE7B purified MaxPab rabbit polyclonal antibody (D01P)