EIF2AK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • EIF2AK1 purified MaxPab rabbit polyclonal antibody (D01P)

EIF2AK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027102-D01P
EIF2AK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EIF2AK1 protein.
Información adicional
Size 100 ug
Gene Name EIF2AK1
Gene Alias HCR|HRI|KIAA1369
Gene Description eukaryotic translation initiation factor 2-alpha kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVIQPRADRAAIELPSLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF2AK1 (NP_055228.2, 1 a.a. ~ 630 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27102

Enviar un mensaje


EIF2AK1 purified MaxPab rabbit polyclonal antibody (D01P)

EIF2AK1 purified MaxPab rabbit polyclonal antibody (D01P)