TAF5L purified MaxPab rabbit polyclonal antibody (D01P)
  • TAF5L purified MaxPab rabbit polyclonal antibody (D01P)

TAF5L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027097-D01P
TAF5L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAF5L protein.
Información adicional
Size 100 ug
Gene Name TAF5L
Gene Alias PAF65B
Gene Description TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF5L (NP_001020418.1, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27097

Enviar un mensaje


TAF5L purified MaxPab rabbit polyclonal antibody (D01P)

TAF5L purified MaxPab rabbit polyclonal antibody (D01P)