TAF5L polyclonal antibody (A01)
  • TAF5L polyclonal antibody (A01)

TAF5L polyclonal antibody (A01)

Ref: AB-H00027097-A01
TAF5L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TAF5L.
Información adicional
Size 50 uL
Gene Name TAF5L
Gene Alias PAF65B
Gene Description TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAF5L (NP_055224, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27097

Enviar un mensaje


TAF5L polyclonal antibody (A01)

TAF5L polyclonal antibody (A01)